|
|
Glass Robot
Added: Sep 19,2024 17:55
Closed: Sep 21,2024 [2 days]
|
|
Features:
|
|
|
Plans: 4.4% hourly for 24 Hours, 110% after 1 Day, 240% after 5 Days
Min deposit: $1
Max deposit: $∞
Referral: 3 Levels: 7% - 1% - 1%
Withdrawal: Instant
|
Total deposited: $804
|
386 views [29 clicks]
Reviews: 000
|
«Glass Robot» summaryThis «RiskRank» metric is a general litmus test for the quality of the «Glass Robot» HYIP took in its entirety, defined by many specifications. Below is a detailed analysis and review of glassrobot.cc and the results from 0 to 10 points.
glassrobot.cc good quality signs
- The website uses Sectigo Limited SSL encryption. All of the incoming and outdoing content is encrypted;
- Not a poor hosting solution looks like a stable and secure server;
- The website content is unique;
- Has a licenced GoldCoders script;
glassrobot.cc poor signs
- Plagiarized design elements from other HYIPs;
- IP 185.186.54.18 that occurs elsewhere for 16 HYIP;
|
This project is a scam and stops paying on Sep 21, 2024.
|
Domain: |
glassrobot.cc is registered for a 1 year
by PDR Ltd. d/b/a PublicDomainRegistry.com [from Sep 19,2024 to Sep 19,2025]
|
|
~ |
SSL
valid for a 12 months - Sectigo Limited
|
+ |
Script: GoldCoders - Licensed
|
+ |
Dedicated server
- 14 domains hosted on IP: 185.186.54.18
|
+ |
Hosting: Genius-Security-Ltd [ geniusguard.com ]
|
+ |
Network: 185.186.x.x [185 projects]
|
- |
|
- |
|
# |
Monitor |
#Pos. |
Status Updated |
Invested |
ROI(%) USD |
Last Payout |
Latest Event |
Added |
|
InvesTracing
|
19 |
not paid
21 Sep 2024
|
$300 |
25%
75 USD |
|
waiting »
not paid1 month ago
|
19 Sep 2024
2 months ago
|
|
InstantMonitor
|
62 |
not paid
23 Sep 2024
|
$300 |
24%
72 USD |
|
waiting »
not paid1 month ago
|
19 Sep 2024
2 months ago
|
20 Sep 2024 RCB |
$639.00 $80.59 |
9 deposits
min: $25
max: $344
avg: $71
|
|
InvesTracing RCB |
$60.00 $12.41 |
2 deposits |
|
Time |
User |
Deposit / RCB |
Status |
17:23:11 |
om* |
$50 / $8.68 |
suspended |
09:33:46 |
ze* |
$30 / $6.01 |
paid |
06:57:11 |
Ka* |
$30 / $6.4 |
paid |
InstantMonitor RCB |
$579.00 $68.18 |
7 deposits |
|
Time |
User |
Deposit / RCB |
Status |
19:16:28 |
St* |
$25 / $1.75 |
Pending |
19:16:28 |
My* |
$25 / $1.75 |
Paid |
10:57:39 |
sa* |
$25 / $1.84 |
Paid |
10:36:50 |
Co* |
$30 / $2.20 |
Paid |
07:08:45 |
ah* |
$100 / $17.07 |
Paid |
04:04:27 |
Ta* |
$30 / $3.56 |
Paid |
03:15:21 |
10* |
$344 / $40.01 |
Paid |
19 Sep 2024 RCB |
$115.00 $11.16 |
4 deposits
min: $25
max: $40
avg: $29
|
|
InvesTracing RCB |
$75.00 $8.22 |
3 deposits |
|
Time |
User |
Deposit / RCB |
Status |
23:11:35 |
da* |
$25 / $2.74 |
paid |
22:41:31 |
Fo* |
$25 / $2.74 |
paid |
22:24:43 |
ma* |
$25 / $2.74 |
paid |
InstantMonitor RCB |
$40.00 $2.94 |
1 deposit |
|
Time |
User |
Deposit / RCB |
Status |
20:06:06 |
Ab* |
$40 / $2.94 |
Paid |
|
Summary of Deposits updated: Sep 21,2024 08:12:02 |
InstantMonitor
RCB
|
$619.00
$71.12
|
8 deposits
min: $25
max: $344
avg: $78
|
|
Top 10 Deposits |
Users with multiple deposits: 0 |
Time |
User |
Deposit / RCB |
Status |
Sep 20,2024 03:15:21 |
10*** |
$344 / $40.01 |
Paid |
Sep 20,2024 07:08:45 |
ah*** |
$100 / $17.07 |
Paid |
Sep 19,2024 20:06:06 |
Ab*** |
$40 / $2.94 |
Paid |
Sep 20,2024 04:04:27 |
Ta*** |
$30 / $3.56 |
Paid |
Sep 20,2024 10:36:50 |
Co*** |
$30 / $2.20 |
Paid |
Sep 20,2024 10:57:39 |
sa*** |
$25 / $1.84 |
Paid |
Sep 20,2024 19:16:28 |
My*** |
$25 / $1.75 |
Paid |
Sep 20,2024 19:16:28 |
St*** |
$25 / $1.75 |
Pending |
InvesTracing
RCB
|
$135.00
$20.63
|
5 deposits
min: $25
max: $30
avg: $27
|
|
Top 10 Deposits |
Users with multiple deposits: 0 |
Time |
User |
Deposit / RCB |
Status |
Sep 20,2024 06:57:11 |
Ka*** |
$30 / $6.4 |
paid |
Sep 20,2024 09:33:46 |
ze*** |
$30 / $6.01 |
paid |
Sep 19,2024 22:24:43 |
ma*** |
$25 / $2.74 |
paid |
Sep 19,2024 22:41:31 |
Fo*** |
$25 / $2.74 |
paid |
Sep 19,2024 23:11:35 |
da*** |
$25 / $2.74 |
paid |
|
Here's what it says on the glassrobot.cc website:
GLASS ROBOT is an
investment platform that uses artificial intelligence and robotics
technologies to analyze and automate investment decisions in
cryptocurrency assets. The core concept is to create a transparent,
robot-driven platform that optimizes investment strategies based on big
data and predictive models.
You don't need to get into
complex details. All you need to do is choose the right deposit plan
and the platform will automatically start earning for you using advanced
AI algorithms and cryptocurrency market analytics. We offer a fully
automated process with a transparent income accrual system, so you can
see the performance of your deposit without being distracted by the
details.
The GLASS ROBOT platform
operates 24/7, without weekends and holidays. Artificial intelligence
analyzes the market and makes decisions in real time, allowing you to
profit from any market situation, even when you sleep.
The platform's referral
program allows users to earn not only on their investments, but also
receive rewards from investments of friends and their referrals up to
the third level, which makes the program one of the most generous on the
market.
GLASS ROBOT LTD is
registered in the UK, which guarantees high security standards and
compliance with strict international financial regulations. This
strengthens user confidence in the platform and ensures reliable legal
protection.
The unique feature of
GLASS ROBOT is simplicity for users. An investor does not need to track
market trends or understand complex charts - just open a deposit, and
the robot will manage investments automatically, bringing stable
accruals.
GLASS ROBOT LTD is an officially registered UK-based
financial technology company specializing in the automation of
investment processes using artificial intelligence and robotics. We
offer innovative solutions for managing cryptocurrency assets, providing
our clients with simplicity and reliability in the world of digital
finance.
The company follows strict international standards in
financial technology, which guarantees transparency and security of all
transactions on the platform. Thanks to our UK registration, we operate
within one of the most trusted and regulated financial markets in the
world.
Join our referral program
and start earning extra income by inviting friends and partners to the
GLASS ROBOT platform. Our tiered program offers generous rewards at
every stage!How it works:
When you invite new users to the platform through your unique referral
link, you receive a percentage of their investment for three tiers:Level 1: Earn 7% of all investments made by your direct referrals (those you personally invited).unique solution: robot investors capablebased financial technology company specializingtiered program offers generous rewardsensures reliable legal protectionstart earning extra incomeoptimizes investment strategies basedstrict international financial regulationstransparent income accrual systempartnership program cryptocurrency immersecombines advanced artificial intelligenceguarantees high security standardsstrict international standardsglass robot platform operatesautomatically start earningregulated financial marketsadvanced ai algorithmsstrengthens user confidencefully automated processbringing stable accrualsunique referral linkmaking optimal decisionsunderstand complex chartsmanaging cryptocurrency assetsartificial intelligence analyzespredicting market trendstrack market trendsautomate investment decisionscryptocurrency market analyticsoffer innovative solutionsfinancial technologyofficially registered ukmanage investments automaticallyglass robot platformunique featurecryptocurrency assetsartificial intelligencereferral programguarantees transparencyreceive rewardsglass robotcryptocurrency investmentsinvestment processestransparent investmentsmarket situationmakes decisionsinvestment platformuk registrationpredictive modelstech financecore conceptanalyzing millionsreal timedigital financecomplex detailsinvestments madedriven platformparticipants invitedpersonally inviteddirect referralsautomation technologiesrobotics technologiesbig datatiers:leveldeposit planinviting friendscompanygenerouslevel referralsprogramsecurityhighinvestmentrobottransparentmarketukmanageregisteredinvestmentsplatforminvitedofferautomationreceiveroboticsreferralsdatamakesdetailslevelfriendsdeposit
|
Host : |
glassrobot.cc |
Registrar : |
PDR Ltd. d/b/a PublicDomainRegistry.com |
|
Nameservers : |
ns1.easy-geo-dns.com (185.136.96.181)
ns2.easy-geo-dns.com (185.136.97.181)
ns3.easy-geo-dns.com (185.136.98.181)
ns4.easy-geo-dns.com (185.136.99.181)
|
|
Created : | 2024-09-19 |
---|
Expires : | 2025-09-19 |
---|
Updated : | 2024-09-19 |
---|
|
|
|
Latest Events
|
|
|
Hourlywoo
Myinvestblog 4 hours ago
changed |
paying »
waiting
|
|
|
Penthainvest
Instantmonitor 10 hours ago
changed |
waiting »
not paid
|
|
|
Lexx
Instantmonitor 10 hours ago
changed |
waiting »
paying
|
|
|
Hashfactor
Hyipexplorer 12 hours ago
changed |
waiting »
problem
|
|
|
Niolic.com
Fairmonitor 15 hours ago
changed |
waiting »
paying
|
|
|
Lexx
Investracing 15 hours ago
changed |
waiting »
paying
|
|
|
|
|
|