Check out HYIPs with HYIP.biz

Reviews+42 | Payouts |  Blacklist |  All Monitors |  FF add-on |  Widgets |  Advertising |  Add Project |  Contact Us
Server Time: 20 Sep 2024 00:15:50
Last Update: 20 Sep 2024 00:00:03
 
Join with: 
 
Glass Robot
5.3
Glass Robot
+
Added: Sep 19,2024 17:55
Payment systems:
Features:
ddos protection
Paiyng2
Plans: 4.4% hourly for 24 Hours, 110% after 1 Day, 240% after 5 Days
Min deposit: $1
Max deposit: $∞
Referral: 3 Levels: 7% - 1% - 1%
Withdrawal: Instant
Total deposited: $115 RCB offers:2 20 views [3 clicks] Reviews: 000
Forum(s): DTMRCDMT
Telegram(s): @glassrobotcc
Domain: glassrobot.cc is registered for a 1 year by PDR Ltd. d/b/a PublicDomainRegistry.com
[from Sep 19,2024 to Sep 19,2025]
~
ssl SSL valid for a 12 months - Sectigo Limited
+
Licensed Script: GoldCoders - Licensed
+
Dedicated Server  Dedicated server - 14 domains hosted on IP: 185.186.54.18
+
Hosting: Genius-Security-Ltd [ geniusguard.com ] +
IP: 185.186.54.18 [used in: 11 projects]
Network: 185.186.x.x [175 projects] United Kingdom
-
Found similar content [design: 1 project]
-

Similarities of glassrobot.cc based on statistic researching

Here are closed projects with similar payouts plans as 4.4% hourly for 24 Hours, 110% after... and included other metrics;
that's stopped pay after min: 2 max: 10 avg: 5 days from a project start date.
Found [76 projects] with proximate payouts plans in total.

Latest Reviews
Be first to add a vote/review and share your statement about "glassrobot.cc"
Join using Google, Telegram, Facebook, Twitter account or e-mail!
Increase your affiliate commission most easily!

All Monitors
# Monitor #Pos. Status
Updated
Invested ROI(%)
USD
Last Payout Latest Event Added
+ InvesTracing 20
paying
19 Sep 2024
$300 18%
54 USD
19 Sep 2024
1 hour ago
waiting » paying
1 hour ago
19 Sep 2024
6 hours ago
+ InstantMonitor 22
paying
20 Sep 2024
$300 2%
6 USD
19 Sep 2024
4 hours ago
waiting » paying
3 hours ago
19 Sep 2024
6 hours ago

RCB Offers *click investmnet amount to sort by higher rcb
# First Investmnet
Second Investmnet
$5 $10 $20 $50 $100 $200 $300 $400 $500 $1000
+ InvesTracing - - - $5.2
$3.7
$13.9
$7.7
$21.9
$14.8
$29.9
$22.0
$38.0
$30.0
$47.0
$38.0
$85.0
$74.0
+ InstantMonitor - - $1.4
$1.4
$3.5
$3.5
$7.0
$7.0
$14.0
$14.0
$21.0
$21.0
$28.0
$28.0
$35.0
$35.0
$70.0
$70.0
RCB Deposit Flow
 
19 Sep 2024
RCB
$115.00
$11.16
4 deposits
min: $25 max: $40 avg: $29
Summary of Deposits
updated: Sep 20,2024 00:10:02
InvesTracing
RCB
$75.00
$8.22
3 deposits
InstantMonitor
RCB
$40.00
$2.94
1 deposit

Content
#Tags

Here's what it says on the glassrobot.cc website:

GLASS ROBOT is an investment platform that uses artificial intelligence and robotics technologies to analyze and automate investment decisions in cryptocurrency assets. The core concept is to create a transparent, robot-driven platform that optimizes investment strategies based on big data and predictive models. You don't need to get into complex details. All you need to do is choose the right deposit plan and the platform will automatically start earning for you using advanced AI algorithms and cryptocurrency market analytics. We offer a fully automated process with a transparent income accrual system, so you can see the performance of your deposit without being distracted by the details. The GLASS ROBOT platform operates 24/7, without weekends and holidays. Artificial intelligence analyzes the market and makes decisions in real time, allowing you to profit from any market situation, even when you sleep. The platform's referral program allows users to earn not only on their investments, but also receive rewards from investments of friends and their referrals up to the third level, which makes the program one of the most generous on the market. GLASS ROBOT LTD is registered in the UK, which guarantees high security standards and compliance with strict international financial regulations. This strengthens user confidence in the platform and ensures reliable legal protection. The unique feature of GLASS ROBOT is simplicity for users. An investor does not need to track market trends or understand complex charts - just open a deposit, and the robot will manage investments automatically, bringing stable accruals. GLASS ROBOT LTD is an officially registered UK-based financial technology company specializing in the automation of investment processes using artificial intelligence and robotics. We offer innovative solutions for managing cryptocurrency assets, providing our clients with simplicity and reliability in the world of digital finance. The company follows strict international standards in financial technology, which guarantees transparency and security of all transactions on the platform. Thanks to our UK registration, we operate within one of the most trusted and regulated financial markets in the world. Join our referral program and start earning extra income by inviting friends and partners to the GLASS ROBOT platform. Our tiered program offers generous rewards at every stage!How it works: When you invite new users to the platform through your unique referral link, you receive a percentage of their investment for three tiers:Level 1: Earn 7% of all investments made by your direct referrals (those you personally invited).
Glass Robotunique solution: robot investors capablebased financial technology company specializingtiered program offers generous rewardsensures reliable legal protectionstart earning extra incomeoptimizes investment strategies basedstrict international financial regulationstransparent income accrual systempartnership program cryptocurrency immersecombines advanced artificial intelligenceguarantees high security standardsstrict international standardsglass robot platform operatesautomatically start earningregulated financial marketsadvanced ai algorithmsstrengthens user confidencefully automated processbringing stable accrualsunique referral linkmaking optimal decisionsunderstand complex chartsmanaging cryptocurrency assetsartificial intelligence analyzespredicting market trendstrack market trendsautomate investment decisionscryptocurrency market analyticsoffer innovative solutionsfinancial technologyofficially registered ukmanage investments automaticallyglass robot platformunique featurecryptocurrency assetsartificial intelligencereferral programguarantees transparencyreceive rewardsglass robotcryptocurrency investmentsinvestment processestransparent investmentsmarket situationmakes decisionsinvestment platformuk registrationpredictive modelstech financecore conceptanalyzing millionsreal timedigital financecomplex detailsinvestments madedriven platformparticipants invitedpersonally inviteddirect referralsautomation technologiesrobotics technologiesbig datatiers:leveldeposit planinviting friendscompanygenerouslevel referralsprogramsecurityhighinvestmentrobottransparentmarketukmanageregisteredinvestmentsplatforminvitedofferautomationreceiveroboticsreferralsdatamakesdetailslevelfriendsdeposit

Domain Information
#Whois
Host : glassrobot.cc
Registrar : PDR Ltd. d/b/a PublicDomainRegistry.com

Nameservers :
ns1.easy-geo-dns.com (185.136.96.181)
ns2.easy-geo-dns.com (185.136.97.181)
ns3.easy-geo-dns.com (185.136.98.181)
ns4.easy-geo-dns.com (185.136.99.181)

Created :2024-09-19
Expires :2025-09-19
Updated :2024-09-19

Monitoring
New HYIP Cfg Liberty
Invested: $150
paying
New HYIP Playpayouts
Invested: $150
paying
New HYIP Uctraders Limited
Invested: $100
paying
New HYIP Bitcobid Limited
Invested: $100
paying
New HYIP Luxio Profit Limited
Invested: $100
paying
New HYIP Bitcoin Wealth
Invested: $100
paying
New HYIPs
New HYIP Glass Robot
6 hours ago
5.3
New HYIP Boss-Pay
13 hours ago
0.1
New HYIP Finnodex
1 day ago
0.1
New HYIP Teal Cat Ai
1 day ago
0.0
New HYIP Ovm-Day
1 day ago
0.1
New HYIP Fx Pips Hunter
1 day ago
2.6
New HYIP Quopex.com
17 Sep 2024
3.5
Latest Events
Recent event
Glass Robot
Investracing 1 hour ago
changed | waiting » paying
Recent event
Fx Pips Hunter
Investracing 1 hour ago
changed | waiting » paying
Recent event
Fx Pips Hunter
Eurohyips 2 hours ago
added | paying
Recent event
Glass Robot
Instantmonitor 3 hours ago
changed | waiting » paying
Recent event
Asignat
Hyiphome 5 hours ago
changed | not paid » problem
Recent event
Asignat
Hyiphome 6 hours ago
changed | problem » not paid
Recent event
Fx Pips Hunter
Hyipclub 6 hours ago
added | paying
Problematic HYIP & Scam
Teal Cat Ai
Closed: 6 hours ago
Arcbotic.com
Closed: 1 day ago
Aurora Assets
Closed: 1 day ago
Mavenpay
Closed: 17 Sep 2024
Maxday
Closed: 17 Sep 2024
Spaas.ltd
Closed: 16 Sep 2024
Alkanoid
Closed: 16 Sep 2024
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback