Check out HYIPs with HYIP.biz
Reviews+1 | Payouts+3 |  Blacklist |  All Monitors |  FF add-on |  Widgets |  Advertising |  Add Project |  Contact Us
Server Time: 10 May 2024 02:03:43
Last Update: 10 May 2024 02:00:02
 
Join with: 
 
Transorous.com
0.0
Transorous.com
+
Added: Mar 26,2023 13:55
Closed: Apr 07,2023 [12 days]
Payment systems:
Features:
ddos protection
Not Paying2
Plans: 3.77% daily for 60 days
Min deposit: $1
Max deposit: $∞
Referral: 4 Levels: 7%-3%-2%-1%
Withdrawal: Instant
Total deposited: $4,509 503 views [34 clicks] Reviews: 400
Forum(s): DTMCGPCDMTMM4RCMMGPPF1
Telegram(s): @transorouschat @Transorous
Warning! The "transorous.com" project is marked as "Blacklist/SCAM" on the following URL(s):
https://mmgp.com/threads/transorous-transorous-com.680316/
https://pf1.ru/topic60168.html
Domain: transorous.com is registered for a 1 year by NameSilo, LLC
[from Jan 26,2023 to Jan 26,2024]
~
ssl SSL valid for a 10 months - Sectigo Limited
+
Licensed Script: GoldCoders - Licensed
+
Dedicated Server  Dedicated server - 1 domain hosted on IP: 185.186.52.92
+
Hosting: Genius-Security-Ltd [ geniusguard.com ] +
IP: 185.186.52.92 [used in: 3 projects]
Network: 185.186.x.x [544 projects] United Kingdom
-
Found similar content [design: 1 project] [text: 362 projects]
-

Latest Reviews
Add a vote/review and share your statement about «transorous.com»
Join using Google, Telegram, Facebook, Twitter account or e-mail!
Upvega
6309 votes 1 year ago Profit Hunters

Dep 1.08 LTC 6dc873586bbab36a9177d4f30da71bb70db149f02a41db20fd656a0145931471 Apr-05-2023 00:08 Transorous Инвестирую с PH

lyuba Kulyk
10770 votes 1 year ago Profit Hunters

Deposit Transorous 100 USDT ceb2715bb379b560c9f195cb3cdbdfa8217e0132baad9b94f5895a6143c9495e 2023-04-05 20:14:21. Инвестирую с Profit-Hunters

Ekaterina Rodina
11315 votes 1 year ago Profit Hunters

Deposit Transorous 100 USDT 0xa70d41060f49dda8556444b80517ac45a50f1c272723d4cbd9e6b0699a77b416 Apr-04-2023 23:47:59 Инвестирую с блогом Profit-Hunters.


All Monitors
# Monitor #Pos. Status
Updated
Invested ROI(%)
USD
Last Payout Latest Event Added
+ InvesTracing 17
not paid
11 Apr 2023
$500 62%
310 USD
06 Apr 2023
1 year ago
waiting » not paid
1 year ago
26 Mar 2023
1 year ago
+ InstantMonitor 71
not paid
10 Apr 2023
$500 63%
315 USD
06 Apr 2023
1 year ago
waiting » not paid
1 year ago
26 Mar 2023
1 year ago
RCB Deposit Flow
 
05 Apr 2023
RCB
$100.00
$24.42
1 deposit
04 Apr 2023
RCB
$750.00
$130.12
2 deposits
min: $300 max: $450 avg: $375
03 Apr 2023
RCB
$429.00
$97.35
5 deposits
min: $50 max: $150 avg: $86
02 Apr 2023
RCB
$370.00
$87.21
4 deposits
min: $20 max: $200 avg: $93
01 Apr 2023
RCB
$320.00
$81.63
3 deposits
min: $100 max: $120 avg: $107
31 Mar 2023
RCB
$180.00
$39.56
2 deposits
min: $50 max: $130 avg: $90
30 Mar 2023
RCB
$450.00
$88.96
3 deposits
min: $100 max: $200 avg: $150
29 Mar 2023
RCB
$120.00
$25.01
2 deposits
min: $20 max: $100 avg: $60
28 Mar 2023
RCB
$500.00
$98.00
4 deposits
min: $100 max: $150 avg: $125
27 Mar 2023
RCB
$111.00
$21.53
3 deposits
min: $30 max: $50 avg: $37
26 Mar 2023
RCB
$1,137.00
$238.67
14 deposits
min: $30 max: $300 avg: $82
Summary of Deposits
updated: Apr 07,2023 18:46:02
InstantMonitor
RCB
$3,000.00
$606.71
21 deposits
min: $50 max: $450 avg: $143
InvesTracing
RCB
$1,467.00
$325.75
22 deposits
min: $20 max: $200 avg: $67

Content
#Tags

Here's what it says on the transorous.com website:

TRANSOROUS is a leading financial technology company that offers innovative investment solutions. Our team of experts has extensive experience in the financial industry and is committed to transforming the way people invest and grow their wealth. Our mission is to provide investors with a reliable and easy-to-use platform to optimize investment performance and minimize risk. With a focus on transparency, accessibility, and flexibility, we aim to create a more accessible and efficient investment landscape for everyone. We believe that by combining our expertise with the power of Knowledge, we can help investors achieve their financial goals and unlock their full potential. To register with transorous.com, simply go to the website, click "Sign Up" and fill out the required information. Once you have completed these steps, you will be able to access your account and start investing. Additionally, it is recommended that you use a secure password for each account and enable two-factor authentication for added security. Gmail is a popular email service provider and can be used for registration To choose a Lucky Investment Package on transorous.com, you will first need to log in to your account and top up your account balance via the Add Funds option. Once your account balance has been updated, you can select the investment plan of your choice. You will be presented with a list of available plans, which can include 12 Hours and 24 Hours plans. Once your purchase is confirmed, you have to wait for the results within 12-24 hours. transorous.com accepts a variety of payment methods for deposits and withdrawals, including Bitcoin, Litecoin, Ethereum, Dash, Ripple, bitcoinCash, Dogecoin, Tether, Tron, Stellar, Tether TRC20, Tether BEP20, BNB. Depending on the payment method you select, you may be subject to fees and other restrictions. the fee will be paid to the wallet provider. During this time, you will not be able to access your funds. If your deposit was on the third turn deposit on the system deposit list, it means you won. After the 12-24 hour period is over, you will be able to access your rewards and use them for your next deposit or to withdraw. It is important to note that the rewards are only valid for each next third turn deposit, and if your turn win, won amount will be be valid for any other type of deposit or withdrawal. It is important to remember that luck can play a part in your success or failure, but it is also important to remember that to check your chance are often even more important. If you feel that you have lost, don't give up. Try again buy Lucky Package and you may win your reward. If you don't want to invest, you can share your referral link to earn referral commissions from deposits made by your referrals. transorous.com offers 4 levels of referral commissions: first level 7%, second level 3%, third level 2%, fourth level 1%, You can share your referral link with anyone you choose, and you'll earn referral commissions for every successful deposit made by your referrals. Referral Commission. Invite Friends & Get Free Bitcoin. Join one of the best cryptocurrency affiliate programs and earn with minimum effort overall, Binance offers excellent commission fees for its affiliates. You can earn money by referring individuals to our system through our referral program. With our help, you can form the greatest team possible. We have a three-level referral program with commissions of 5%, 3%, 2% and 1%. Try to persuade as many individuals as you can; each new person means more money for you. Share your referral link to friends and family, and post it on social media. We will offer you with the essential information and promotional materials. To make a investment you must first become a member of Transorous. Once you are signed up, you can make your first deposit. All deposits must be made through the Members Area. You can login using the member username and password you receive when signup. To make a investment you must first become a member of Transorous. Once you are signed up, you can make your first deposit. All deposits must be made through the Members Area. You can login using the member username and password you receive when signup. To make a spend you must first become a member of Transorous. Once you are signed up, you can make your first spend. All spends must be made through the Member Area. You can login using the member username and password you received when signup. Yes! To make a deposit from your Transorous account balance. Simply login into your members account and click on Make Deposit ans select the Deposit from Account Balance Radio button. There is a risk involved with investing in all high yield investment programs. However, there are a few simple ways that can help you to reduce the risk of losing more than you can afford to. First, align your investments with your financial goals, in other words, keep the money you may need for the short-term out of more aggressive investments, reserving those investment funds for the money you intend to raise over the long-term. It's very important for you to know that we are real traders and that we invest members' funds on major investments.
Transorous.combinance offers excellent commission feespopular email service providerleading financial technology companyoffers innovative investment solutionshigh yield investment programsaccount balance radio buttonll earn referral commissionsmake deposit ans selectcryptocurrency affiliate programsefficient investment landscapeoptimize investment performancebuy lucky packageinvite friends &lucky investment packageadd funds optionminimum withdrawal limitearn referral commissionslifetime referral rewardslevel referral programsuccessful deposit madereferral commissiontransorous account balancesystem deposit listoffers 4 levelslucky packagereferral commissions:wallet providerreferral programaffiliate programaccount balanceinvestment planreferral linkminimum effortll rewardfinancial industryfinancial goalsinvestment fundsincluding bitcoinpayment methodpayment methodssupported assetsmembers areamembers accountsimple waysreal traderspromotional materialsessential informationfree bitcoinfactor authenticationsocial mediaremain secure4 hour periodfull potentialextensive experienceprovide investorsinvestors achieverequired informationturn depositdirect depositearn moneyminimize risktether beppeople investaggressive investmentstether trcmajor investmentsinvest membersrisk involvedfourth levelmember usernamemember areastart investingperson meansadded securitywon amountturn winreferring individualsgreatest teamsecure passwordfeesdeposits made4 hours planssimply logininvestmentearncommissionswithdrawalfriendslistselectsystemaccountdepositriskinvestmentsinvesttethermadefundslevel 7%levelmembermeansindividualswonteamrewardinvestingwinsimplyplansrewardsaddedmakehourslogin4 hoursmoneypassworddepositstransorous

Domain Information
#Whois
Host : transorous.com
Registrar : NameSilo, LLC

Nameservers :
ns1.easy-geo-dns.com (185.136.96.181)
ns2.easy-geo-dns.com (185.136.97.181)
ns3.easy-geo-dns.com (185.136.98.181)
ns4.easy-geo-dns.com (185.136.99.181)

Created :2023-01-26
Expires :2024-01-26
Updated :2023-03-14

Monitoring
New HYIP Bitaveo.com
Invested: $200
paying
New HYIP Cfg Liberty
Invested: $150
paying
New HYIP Uctraders Limited
Invested: $100
paying
New HYIP Bitcoin Wealth
Invested: $100
paying
New HYIP Bitcobid Limited
Invested: $100
paying
New HYIP Luxio Profit Limited
Invested: $100
paying
New HYIPs
New HYIP Azariacapital
11 hours ago
0.2
New HYIP Vip Gold
14 hours ago
0.1
New HYIP Wezel Holding
1 day ago
1.1
New HYIP Best-Trade
1 day ago
0.1
New HYIP Earnten
1 day ago
3.4
New HYIP Tokentrax.vip
07 May 2024
0.8
New HYIP Metal2024
07 May 2024
0.1
Latest Events
Recent event
Tokentrax.vip
Instantmonitor 6 hours ago
changed | paying » waiting
Recent event
Vintal
Eurohyips 6 hours ago
added | waiting
Recent event
Azariacapital
Sqmonitor 11 hours ago
added | paying
Recent event
Vip Gold
Tradinghyips 12 hours ago
added | paying
Recent event
Vip Gold
Ishprash 12 hours ago
added | paying
Recent event
Hourlywoo
Hyips.bz 13 hours ago
added | paying
Recent event
Vip Gold
Bakster 14 hours ago
added | paying
Problematic HYIP & Scam
Jimfryrealestate
Closed: 21 hours ago
Stakingi
Closed: 21 hours ago
Phoenixcaplimited
Closed: 21 hours ago
Besthour
Closed: 21 hours ago
Aka07
Closed: 1 day ago
Https://investbox.cc
Closed: 1 day ago
Metalhourly
Closed: 1 day ago
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback