Check out HYIPs with HYIP.biz
Reviews+49 | Payouts+1 |  Blacklist |  All Monitors |  FF add-on |  Widgets |  Advertising |  Add Project |  Contact Us
Server Time: 19 May 2024 01:21:50
Last Update: 19 May 2024 01:00:03
 
Join with: 
 
Tatwex
0.0
Tatwex
+
Added: Jan 08,2018 22:07
Closed: Feb 11,2018 [34 days]
Payment systems:
Features:
ddos protection
Not Paying9
Plans: 6% up to 9% daily for 14 up to 28 calendar days, initial...
Min deposit: $10
Max deposit: $∞
Referral: 5%
Withdrawal: Manual
1047 views [4 clicks] Reviews: 000
ssl PositiveSSL valid for a 12 months - COMODO CA Limited
+
Hosting: [ ddos-guard.net ] +
IP: 190.115.18.126 [used in: 3 projects]
Network: 190.115.x.x [2271 projects] Belize
-

Latest Reviews
Be first to add a vote/review and share your statement about "tatwex.com"
Join using Google, Telegram, Facebook, Twitter account or e-mail!

All Monitors
# Monitor #Pos. Status
Updated
Invested ROI(%)
USD
Last Payout Latest Event Added
+ InvesTracing 29
not paid
12 Feb 2018
$500 -
07 Feb 2018
6 years ago
paying » not paid
6 years ago
30 Jan 2018
6 years ago
+ Incredible Earnings 21
not paid
11 Feb 2018
$80 102%
81.6 USD
09 Feb 2018
6 years ago
paying » not paid
6 years ago
08 Jan 2018
6 years ago
+ InstantScamAlert 6
not paid
10 Mar 2018
$300 220%
660 USD
09 Feb 2018
6 years ago
waiting » not paid
6 years ago
27 Jan 2018
6 years ago

Content
#Tags

Here's what it says on the tatwex.com website:

Investment plans was executed to return a steady daily interest that will be credited automatically to your account balance every day (from Monday to Sunday) until your principal of deposit has expired. Upon expiry, the invested sum is absorbed and you will stop making further profits unless you invest any new funds further. The company will help you to maximize personal income through the use of affiliate tools. Just sign up to receive a unique referral link, using of which will bring you 5% of deposits of all your referrals. Besides, in your personal account you will find attractive animated banners that can be used anywhere: on investment forums, websites or personal blogs. The wider audience of these resources, the more likely increasing in the number of your referrals and consequently your income! No matter if you are trader, quant or software engineer, TatWex gives you complete access to deeper, richer, high-precision, GPS time-stamped market data for equities, futures, options and FX. Benchmark your strategies, trading performance and data all in one place. When we say, data transparency comes first, we mean it. We start with richer, faster raw packet capture of every relevant piece of data - in other words, everything. This gives you more timely and accurate reporting, sophisticated surveillance and most important, improved real-time trading insight. As markets grow more automated, split-second decisions are made by algorithms, financial data and analytics. We seek elegant solutions that eliminate needless complexity, provide easy access to the highest-precision data and deliver developer tools that let you focus on what matters. We offers the most modern technology platform, high-precision data and sophisticated analytics. Clients benefit from connectivity to investment-based platform for complex financial analysis. Leverage the latest technology to gain transparency and insight into investments. We have been preparing our website for many months and now we are ready to introduce our online investment platform TatWex. As far as possible, we have set out to ensure that our website is compatible with open web standards. We therefore recommend that you access this website using modern web browsers like Chrome, Firefox, and Safari. This website is also optimised for modern mobile devices so that you may reach it on the move. TatWex main goal is to achieve the highest profits possible from activity on the foreign currency exchange (Forex), Stock Market and Cryptocurrency exchange markets. So we have one of the most interesting investment opportunity in the web. We are glad to welcome every visit to become a part of something interesting, don't miss it out. We accept members from all over the world. Thank you again for visiting our website, and we hope you enjoy using it. TatWex is an automated trading platform which utilizes powerful computers to transact a large number of orders at extremely high speeds. These high frequency trading platform allow to execute millions of orders and scan multiple markets and exchanges in a matter of seconds, thus giving a huge advantage in the open market. The system use complex algorithms to analyse the markets and are able to spot emerging trends in a fraction of a second. By being able to recognize shifts in the marketplace, the trading system send hundreds of baskets of stocks out into the marketplace at bid-ask spreads that are advantageous to the traders. By essentially anticipating and beating the trends to the market place, TatWex implement high frequency trading and get favourable returns on trades they make by essence of their bid-ask spread, resulting in significant profits. We have developed our own cutting edge technology that utilizes HFT (High Frequency Trading) in its best ability and along the way we had discovered that all digital transactions can be monitored and analysed, that’s why using computers and algorithmic softwares combined with a team of specialists and analysts will help provide us with a projection on which we built our strategy. With many years under our belt trying to perfect this, we have accomplished the best through trial and error, multitudes of money and the best specialists on the job to give you access to HFT (High Frequency Trading) that is connected with Managed accounts and PAMM Accounts to help you gain attractive profits. Please check the Frequently Asked Questions page first before sending us an inquiry. Who knows, perhaps the answer you seek is already written in our page. If you have any further questions about investments our experts are ready to help you at any time. Company customer support is available around the clock. You only have to send us email or submit a request via the feedback form to promptly receive the necessary assistance. Remember that the more detailed description of your problem is, the faster it will be solved. Any individual or corporation from any country may open an account with us and we are happy to accept investors from any place in the world. The only condition is accepting our terms of service. No, all accounts with matching address and wallet number or using fake address and personal information will be verified and suspended, if we will not be able to check the identity of the account holder. Our affiliate program has only one level and will bring you 5% of deposits of all your referrals. This means that you get rewarded from only your direct referrals after they invest. The information provided by Our clients is an important part of building relations with them. We want You to know what We do with Your private information and how We use it. We are doing Our best to protect Your privacy. Your information may only be used by authorized employees of the Company in case of necessity. We continuously review Our systems, software and databases to ensure the best possible services to Our clients. We keep confidential Your personal data like Your email address. We do our best to restrict access to it to only Our employees who are authorized to have such access. We never disclose or sell this information to anyone. While providing Our financial services to You, certain non-public information about You may be requested. In accordance with Our policy, We keep this information strictly confidential and We will not use this information for any purposes which are not related with provision of Our services to You, or disclose this information to any third parties unless otherwise is required by law. We have procedures in place which We believe to be properly designed to ensure the security and confidentiality of Your data. They include confidentiality, password-protected user access to Our systems, software files and databases as well as strict confidentiality policies. We are using an SSL certificate (SHA-256 RSA encryption) which is currently the most trusted and the most reliable SSL (Security Socket Layers) option. Data Protection Act 1998 is a mandatory document which is binding for Us. In accordance with the said Act, any client information collected may be passed to third parties. However, client data are considered confidential and will not be disclosed to any third party, unless We are obliged to do so upon an official request of appropriate authorities. Clients have the right to view or receive any client records, which We keep, upon the first request. We never sell, disclose or in any other way dispose of Your personal information for Our benefit or without benefit, or use Your e-mail address for sending unsolicited mail. Any emails which We send to You will only be a part of the services which We provide to You as Our Client or subscriber. exclude any representations and/or warranties connected with this website and its contents, including in relation to any errors or omissions which may from time to time be found on in this website; and exclude any liability for damages resulting from Your use of this website. This includes, without limitation, any direct loss, loss of business, loss of profit (whether or not foreseeable, arising in the normal course of things), damage to Your computer, computer software, software systems and programs and any data on them, or any other direct or indirect, consequential and incidental damages. Clients perform all financial transactions solely at their own discretion and their own risk. The Customer personally decides whether or not to invest and how much to invest. The interest rate depends on the selected investment package while each investment package allows for investing different amounts. We reserve the right to change minimum and maximum amount to deposit for every investment package without any additional notification. The services provided through this Website are generally available worldwide. All advertising and promotion is intended for the global market. You are solely responsible for making sure that Our services are suitable for Your particular purposes. You may not redistribute or reproduce this Website or a part of it, unless otherwise is expressly permitted by the Company. The Company does not guarantee uninterruptible availability of this Website or timely or error-free content, however, the guaranteed uptime of this Website is up to 99%. Distributed Denial of Service (DDoS) is known as one of the most ubiquitous and damaging attacks in cyberspace. In response to the increasing concern of DDoS attacks, Our IT specialists are using professional anti-DDoS solutions to protect the Website against most known types of attacks. We reserve the right temporarily terminate or suspend the delivery of information through this Website without prior notice. It can happen when We need to supplement, update, delete or modify the content of this Website. The Website can be shut down temporarily in case of urgent system updates, equipment failures, power cutoffs or natural disasters. We use IP addresses, from which Our clients visit this Website, to analyse trends, track user movements and gather demographic information. IP addresses are never linked to personally identifiable information. Additionally, Our web servers log standard client access information which includes browser type, requested URL and referral URL. This information is kept confidential and not shared with third parties. Any individually identifiable information will never be used in any way other than stated above unless We have a written permission from You for such disclosure. Our Website uses cookies to retrieve user details during each visit. Cookies are small text files which are sent to Your browser by Our server and recorded to Your computer. Cookies are totally harmless and cannot contain any malware. If cookies are disabled in Your browser, the Website may work incorrectly. The affiliate program is a way to get extra earnings for referring other people to the services offered through this Website. You do not have to make a deposit or have an active investment to get affiliate bonuses. Clients are not allowed to send SPAM or any kind of unsolicited commercial e-mail to promote the Company, its services. The Company will remove accounts of SPAM senders immediately. The affiliate program uses one-level referral commission which will pay 5% from each deposit made by your referrals (people referred by your direct invites). You can find information about the Company on a variety of monitoring websites, blogs, forums and social networks. We do not track information published by such websites. Opinions or materials provided by such websites may differ from the opinions and materials published on this Website and are not endorsed or shared by the management of the Company. We are not responsible for the privacy policies and other regulations used by third-party websites. So, when You leave this Website, please make sure You have read and understood the privacy and other client-related provisions of those websites. The Company is in no way responsible for any loss or damage or disclosure of Your personal data resulting from the use of the third-party websites. Any opinions expressed by employees or representatives of our company as to the currency exchange rates are just opinions which do not imply any guarantees. In addition, there are risks which are related to the use of an Internet-based deal execution trading system and include risks connected with possible hardware or software failures. Neither party is liable to the other party for any failure to perform any obligation which is resulted by any event beyond the control of such party, including, but not limited to any Acts of God, terrorism, war, political insurgence, insurrection, riot, civil unrest, act of civil or military authority, uprising, earthquake, flood or any other natural or other disasters, which cannot be reasonably foreseen or avoided. Any Party affected by such event shall forthwith inform the other Party of the same and shall use all reasonable endeavours to comply with these Terms and Conditions. Failure of either Party to insist upon strict performance of any provision of these Terms and Conditions or the failure of either Party to exercise any right or remedy to which it, he or they are entitled hereunder shall not constitute a waiver thereof and shall not cause a diminution of the obligations hereunder. No waiver of any of the provisions of these Terms and Conditions shall be effective unless it is expressly stated to be such and signed by both Parties. The laws of the United Kingdom govern these Terms and Conditions. Only individuals in the age of majority may register and use Our investment services. By accessing this Website and using Our services You accept these Terms and Conditions. If any provisions of these Terms and Conditions are deemed invalid or unenforceable for any reason (including, but not limited to the exclusions and limitations set out above), then the invalid or unenforceable provisions will be severed from these Terms and Conditions, while the remaining provisions will stay intact. Failure of the Company to enforce any of the provisions set out in these Terms and Conditions shall not be construed as waiver of such provisions and shall not affect the validity of these Terms and Conditions or the right thereafter to enforce each and every provision. These Terms and Conditions shall not be amended, modified, varied or supplemented except in writing and signed by duly authorized representatives of the Company. The Company reserves the right to change these Terms and Conditions from time to time as it sees fit and Your continued use of this Website will mean Your acceptance of any amendments to these Terms and Conditions. In case of changes to the privacy policy, We will announce such changes on the homepage and other key pages of this Website. In case of amendments to the client data practices, clients who are affected by such amendments will be notified by e-mail. Any amendments to the privacy policy will be posted on this Website 30 days prior to these amendments to become effective. You are therefore advised to re-read these Terms and Conditions regularly.
Tatwexweb servers log standard client access informationbased deal execution trading systemtatwex implement high frequency tradingpayment batch details/ screenshotfind attractive animated bannersfaster raw packet capturehigh frequency trading platformfrequently asked questions pagetrading system send hundredsonline investment platform tatwexhigh frequency tradingmodern web browsersunited kingdom governtrack user movementseliminate needless complexityforeign currency exchangecurrency exchange ratesmodern mobile devicesurgent system updatesalgorithmic softwares combinedcustomer personally decidesfind upline idmodern technology platformextremely high speedstatwex main goalcutting edge technologyretrieve user detailsinterest rate dependsautomated trading platformwithdraw amount equivalentspam senders immediatelyprotected user accessopen web standardsmake deposit: perfect moneyguarantee uninterruptible availabilitysmall text filesdeliver developer toolsgather demographic informationindividually identifiable informationpersonally identifiable informationcryptocurrency exchange marketsscan multiple marketsunique referral linksteady daily interestsecurity socket layerscomplex financial analysisgain attractive profitsspot emerging trendstrack information publishedclient information collectedselected investment packagecheck sponsor usernamelevel referral commissionutilizes powerful computersseek elegant solutionsclient data practicesfinancial transactions solelymaximize personal incomeinteresting investment opportunitystamped market datainformation strictly confidentialstrict confidentiality policiesduly authorized representativesprovide easy accesstime trading insightcompany customer supportbased platformincludes browser typedata protection actinclude risks connectedpersonal data resultingsending unsolicited mailtrading performancetrading risksfind informationwithdrawal systeminvestment packagereferral urlinterest incometatwex requireslatest technologypersonal informationgain transparencyguarantee confidentialitydaily repaymentsclient datafinancial datasend spamunsolicited commercialinclude confidentialitysupport formmaximum amountrestrict accessmaterials publishedaffiliate toolsstrict performancecomplete accessclient recordsref linkdigital transactionsregistration pagesoftware filespersonal dataprivate informationinformation providedpublic informationinvestment plansactive investmentmarkets growglobal marketstock marketopen marketddos solutionsprivacy policiesexpressly permittedmandatory documentsignificant profitsbuilding relationsdays priorfavourable returnsguaranteed uptimerecognize shiftscontinuously reviewcomplex algorithmshuge advantageprofessional antidistributed denialmilitary authorityutilizes hftreliable sslinvested sum56 rsa encryptionincidental damagesdetailed descriptionprior noticewithdrawal requestsdamages resultingfacing issuesproperly designedwarranties connectedmatching addressfake addressaffiliate programadditional notificationcredited automaticallyreferrer datassl certificatesecurity reasonskey pagesfeedback formsees fitessentially anticipatingwider audienceentitled hereundersocial networksextra earningswork incorrectlypersonal accountobligations hereundertotally harmlessreasonable endeavoursmaterials providedforthwith informstabilization fundpolitical insurgencedata transparencyrelevant pieceimproved realsophisticated surveillanceaccurate reportingip addressesaffiliate bonusesstay intactpower cutoffsexecute millionsequipment failuresfinancial servicestransactions arisingsoftware failuressoftware engineersolely responsiblepersonal blogspamm accountsmanaged accountsinvestment forumsdirect invitesremove accountsmissing depositmail addressconsidered confidentialaccount holderaccount dependingcreating accountaccept investorslarge numberprecision dataaccept membersdamaging attackswallet numberlimitations setinvestment servicesremaining provisionswebanalyse trendshighest profitsincreasing concernpeople referredsophisticated analyticscivil unrestfree contentprincipal includedexpressly statedwritten permissionstop makingfuture returntemporarily terminatechange minimumrequested urldeemed invalidemail addressmonitoring websitesmarket placeservices offeredservices providedgps timeddos attackspromptly receiveauthorized employeeswaiver thereofprivacy policydeposit madebitcoin depositofficial requestopinions expressedprovisions setaccount balancecompany reservessoftware systemscomputer softwareconditions regularlyunenforceable provisionsdirect lossnatural disasterssystemdirect referralsrelated provisionshighclients performparty affectedimportant partparty websitesdetailsclients benefitclients visittatwexclientmoneyfasterquestionsperfectaccesspageinformationmarketsinvestmentinsightdatariskslevelcomputersinterestingauthorizedtrendsincomesendopenautomatedresultingconnectedseekprofitsincludesrepresentativessecuritysendingconfidentialitysoftwareconfidentialmailmakeaccountsdirectdepositaccountacceptbrowserddosactattackspolicynumberprecisionsetcheckprivacyprovisionsimportantarisingwrittenalgorithmscivilcontentdisasterspeoplemadeunenforceableemailinvalidanalyticsanalysenaturalhftrequestedstatedbitcoinforumsprovideaffectedbalancereturntemporarilyhighestmakingprincipalchangeperformblogsincreasingwebsitesservicestimeresponsiblereceiverelatedclientssystemsvisitwaiveremployeesbenefitcomputerpartyrequestpartopinionslossreferralscompanyplaceconditions

Domain Information
#Whois
Host : tatwex.com
Registrar : NameCheap Inc.

Nameservers :
dns1.registrar-servers.com (216.87.155.33)
dns2.registrar-servers.com (216.87.152.33)

Created :2017-12-21
Updated :2017-12-26

Monitoring
New HYIP Bitaveo.com
Invested: $200
paying
New HYIP Cfg Liberty
Invested: $150
paying
New HYIP Uctraders Limited
Invested: $100
paying
New HYIP Bitcoin Wealth
Invested: $100
paying
New HYIP Bitcobid Limited
Invested: $100
paying
New HYIP Luxio Profit Limited
Invested: $100
paying
New HYIPs
New HYIP Arbinode
9 hours ago
5.3
New HYIP Newgold
12 hours ago
0.1
New HYIP Trenoz.com
1 day ago
4.7
New HYIP Best-Hours
1 day ago
0.1
New HYIP Gobblex Ltd
16 May 2024
0.2
New HYIP Onlybanx
16 May 2024
3.8
New HYIP Pc-Daily
16 May 2024
0.1
Latest Events
Recent event
Newgold
Bakster 7 hours ago
added | paying
Recent event
Arbinode
Eurohyips 9 hours ago
added | waiting
Recent event
Newgold
Ishprash 12 hours ago
added | paying
Recent event
Norman Bank
Richinvestmonitor 14 hours ago
changed | paying » problem
Recent event
Trenoz.com
Investracing 15 hours ago
changed | waiting » paying
Recent event
Hourlywoo
Hyiphome 16 hours ago
changed | not paid » paying
Recent event
Hourlywoo
Hyiphome 16 hours ago
changed | paying » not paid
Problematic HYIP & Scam
Norman Bank
Closed: 14 hours ago
Azariacapital
Closed: 20 hours ago
Shaobank
Closed: 1 day ago
Fast-Oil
Closed: 1 day ago
Speed-Gold
Closed: 1 day ago
Bitmote Limited
Closed: 16 May 2024
Nwc-Trade
Closed: 16 May 2024
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback